SCOPe 2.07: Domain d4acfb1: 4acf B:4-104

Lineage for d4acfb1 (4acf B:4-104)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families)
   automatically mapped to Pfam PF03951

5. Family d.15.9.0: automated matches [227156] (1 protein)
   not a true family

6. Protein automated matches [226862] (4 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [224991] (6 PDB entries)

8. Domain d4acfb1: 4acf B:4-104 [218784]
   Other proteins in same PDB: d4acfa2, d4acfb2, d4acfc2, d4acfd2, d4acfe2, d4acff2
   automated match to d1f52a1
   complexed with 46b, cl, mg, p3s, po4

Details for d4acfb1

PDB Entry: 4acf, 2 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with imidazopyridine inhibitor ((4-(6-bromo-3-(butylamino)imidazo(1,2-a)pyridin-2-yl)phenoxy) acetic acid) and l-methionine-s-sulfoximine phosphate.

PDB Compounds: (B:) glutamine synthetase 1

SCOPe Domain Sequences for d4acfb1:

Sequence; same for both SEQRES and ATOM records:

>d4acfb1 d.15.9.0 (B:4-104) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
ihesdmlllpdpetaridpfraaktlninffvhdpftlepy

Timeline for d4acfb1:

• d4acfb1 first appeared in SCOPe 2.03
  
• d4acfb1 appears in SCOPe 2.06