SCOPe 2.08: Domain d4ac3a2: 4ac3 A:252-459

Lineage for d4ac3a2 (4ac3 A:252-459)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins)
   this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain

6. Protein automated matches [227078] (2 species)
   not a true protein

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [226303] (2 PDB entries)

8. Domain d4ac3a2: 4ac3 A:252-459 [218779]
   Other proteins in same PDB: d4ac3a1
   automated match to d1g95a1
   complexed with r83, so4

Details for d4ac3a2

PDB Entry: 4ac3, 2.1 Å

PDB Description: s.pneumoniae glmu in complex with an antibacterial inhibitor

PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d4ac3a2:

Sequence; same for both SEQRES and ATOM records:

>d4ac3a2 b.81.1.4 (A:252-459) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
vsfvnpeatyididveiapevqieanvilkgqtkigaetvltngtyvvdstigagavitn
smieessvadgvtvgpyahirpnsslgaqvhignfvevkgssigentkaghltyigncev
gsnvnfgagtitvnydgknkyktvigdnvfvgsnstiiapvelgdnslvgagstitkdvp
adaiaigrgrqinkdeyatrlphhpknq

Timeline for d4ac3a2:

• d4ac3a2 first appeared in SCOPe 2.03
  
• d4ac3a2 appears in SCOPe 2.07