Lineage for d4ac3a1 (4ac3 A:2-251)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133197Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (4 protein domains)
  6. 2133247Protein automated matches [226998] (3 species)
    not a true protein
  7. 2133248Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [226302] (2 PDB entries)
  8. 2133250Domain d4ac3a1: 4ac3 A:2-251 [218778]
    Other proteins in same PDB: d4ac3a2
    automated match to d1hm9a2
    complexed with r83, so4

Details for d4ac3a1

PDB Entry: 4ac3 (more details), 2.1 Å

PDB Description: S.pneumoniae GlmU in complex with an antibacterial inhibitor
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d4ac3a1:

Sequence, based on SEQRES records: (download)

>d4ac3a1 c.68.1.5 (A:2-251) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
snfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtvvghkaelvee
vlaeqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgeslknlidfhinh
knvatiltaetdnpfgygrivrndnaevlriveqkdatdfekqikeintgtyvfdnerlf
ealknintnnaqgeyyitdvigifretgekvgaytlkdfdeslgvndrvalataesvmrr
rinhkhmvng

Sequence, based on observed residues (ATOM records): (download)

>d4ac3a1 c.68.1.5 (A:2-251) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
snfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtvvghkaelvee
vlaeqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgeslknlidfhinh
knvatiltaetdnpfgygrivrndnaevlriveqkdatdfekqikeintgtyvfdnerlf
ealknintnngeyyitdvigifretgekvgaytlkdfdeslgvndrvalataesvmrrri
nhkhmvng

SCOPe Domain Coordinates for d4ac3a1:

Click to download the PDB-style file with coordinates for d4ac3a1.
(The format of our PDB-style files is described here.)

Timeline for d4ac3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ac3a2