SCOPe 2.08: Domain d4ac0a2: 4ac0 A:68-203

Lineage for d4ac0a2 (4ac0 A:68-203)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.0: automated matches [227226] (1 protein)
   not a true family

6. Protein automated matches [226967] (6 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [226545] (1 PDB entry)

8. Domain d4ac0a2: 4ac0 A:68-203 [218777]
   Other proteins in same PDB: d4ac0a1
   automated match to d1qpia2
   complexed with mg, miy, po4

Details for d4ac0a2

PDB Entry: 4ac0, 2.45 Å

PDB Description: tetr(b) in complex with minocycline and magnesium

PDB Compounds: (A:) tetracycline repressor protein class b from transposon tn1 0

SCOPe Domain Sequences for d4ac0a2:

Sequence, based on SEQRES records:

>d4ac0a2 a.121.1.0 (A:68-203) automated matches {Escherichia coli [TaxId: 562]}
cplegeswqdflrnnaksfrcallshrdgakvhlgtrptekqyetlenqlaflcqqgfsl
enalyalsavghftlgcvledqehqvakeeretpttdsmppllrqaielfdhqgaepafl
fgleliicglekqlkc

Sequence, based on observed residues (ATOM records):

>d4ac0a2 a.121.1.0 (A:68-203) automated matches {Escherichia coli [TaxId: 562]}
cplegeswqdflrnnaksfrcallshrdgakvhlgtrptekqyetlenqlaflcqqgfsl
enalyalsavghftlgcvledqehqvakeeresmppllrqaielfdhqgaepaflfglel
iicglekqlkc

Timeline for d4ac0a2:

• d4ac0a2 first appeared in SCOPe 2.03
  
• d4ac0a2 appears in SCOPe 2.07