Class a: All alpha proteins [46456] (290 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.0: automated matches [227226] (1 protein) not a true family |
Protein automated matches [226967] (6 species) not a true protein |
Species Escherichia coli [TaxId:562] [226545] (1 PDB entry) |
Domain d4ac0a2: 4ac0 A:68-203 [218777] Other proteins in same PDB: d4ac0a1 automated match to d1qpia2 complexed with mg, miy, po4 |
PDB Entry: 4ac0 (more details), 2.45 Å
SCOPe Domain Sequences for d4ac0a2:
Sequence, based on SEQRES records: (download)
>d4ac0a2 a.121.1.0 (A:68-203) automated matches {Escherichia coli [TaxId: 562]} cplegeswqdflrnnaksfrcallshrdgakvhlgtrptekqyetlenqlaflcqqgfsl enalyalsavghftlgcvledqehqvakeeretpttdsmppllrqaielfdhqgaepafl fgleliicglekqlkc
>d4ac0a2 a.121.1.0 (A:68-203) automated matches {Escherichia coli [TaxId: 562]} cplegeswqdflrnnaksfrcallshrdgakvhlgtrptekqyetlenqlaflcqqgfsl enalyalsavghftlgcvledqehqvakeeresmppllrqaielfdhqgaepaflfglel iicglekqlkc
Timeline for d4ac0a2: