Lineage for d1ctn_1 (1ctn 24-132)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551984Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 552070Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (18 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 552097Protein Chitinase A, N-terminal domain N [49233] (1 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. 552098Species Serratia marcescens [TaxId:615] [49234] (9 PDB entries)
  8. 552106Domain d1ctn_1: 1ctn 24-132 [21876]
    Other proteins in same PDB: d1ctn_2, d1ctn_3

Details for d1ctn_1

PDB Entry: 1ctn (more details), 2.3 Å

PDB Description: crystal structure of a bacterial chitinase at 2.3 angstroms resolution

SCOP Domain Sequences for d1ctn_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ctn_1 b.1.18.2 (24-132) Chitinase A, N-terminal domain N {Serratia marcescens}
aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakillng
keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad

SCOP Domain Coordinates for d1ctn_1:

Click to download the PDB-style file with coordinates for d1ctn_1.
(The format of our PDB-style files is described here.)

Timeline for d1ctn_1: