| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (17 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location |
| Protein Chitinase A, N-terminal domain N [49233] (1 species) precedes the catalytic (beta/alpha)8-barrel domain |
| Species Serratia marcescens [TaxId:615] [49234] (7 PDB entries) |
| Domain d1ctn_1: 1ctn 24-132 [21876] Other proteins in same PDB: d1ctn_2, d1ctn_3 |
PDB Entry: 1ctn (more details), 2.3 Å
SCOP Domain Sequences for d1ctn_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ctn_1 b.1.18.2 (24-132) Chitinase A, N-terminal domain N {Serratia marcescens}
aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakillng
keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad
Timeline for d1ctn_1: