Lineage for d4aaoa2 (4aao A:189-346)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2305066Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2305067Protein automated matches [190453] (25 species)
    not a true protein
  7. 2305082Species Geobacter sulfurreducens [TaxId:243231] [226497] (6 PDB entries)
  8. 2305093Domain d4aaoa2: 4aao A:189-346 [218759]
    automated match to d1nmla2
    complexed with ca, hec, so4

Details for d4aaoa2

PDB Entry: 4aao (more details), 2.3 Å

PDB Description: maca-h93g
PDB Compounds: (A:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d4aaoa2:

Sequence, based on SEQRES records: (download)

>d4aaoa2 a.3.1.0 (A:189-346) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
dapfdkylkgnrkaisstaeqglalfldkgcaachsgvnmggtgyfpfgvredpgpvvrp
vddtgrykvtstaadkyvfrspslrnvaitmpyfhsgkvwklkdavkimgsaqlgisitd
adadkivtflntltgaqpkvmhpvlppnsddtprpvsn

Sequence, based on observed residues (ATOM records): (download)

>d4aaoa2 a.3.1.0 (A:189-346) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
dapfdkylkgnrkaisstaeqglalfldkgcaachsgvnmggtgyfpfgvredykvtsta
adkyvfrspslrnvaitmpyfhsgkvwklkdavkimgsaqlgisitdadadkivtflntl
tgaqpkvmhpvlppnsddtprpvsn

SCOPe Domain Coordinates for d4aaoa2:

Click to download the PDB-style file with coordinates for d4aaoa2.
(The format of our PDB-style files is described here.)

Timeline for d4aaoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4aaoa1