Class a: All alpha proteins [46456] (290 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
Protein automated matches [190453] (26 species) not a true protein |
Species Geobacter sulfurreducens [TaxId:243231] [226497] (6 PDB entries) |
Domain d4aaoa2: 4aao A:189-346 [218759] automated match to d1nmla2 complexed with ca, hec, so4 |
PDB Entry: 4aao (more details), 2.3 Å
SCOPe Domain Sequences for d4aaoa2:
Sequence, based on SEQRES records: (download)
>d4aaoa2 a.3.1.0 (A:189-346) automated matches {Geobacter sulfurreducens [TaxId: 243231]} dapfdkylkgnrkaisstaeqglalfldkgcaachsgvnmggtgyfpfgvredpgpvvrp vddtgrykvtstaadkyvfrspslrnvaitmpyfhsgkvwklkdavkimgsaqlgisitd adadkivtflntltgaqpkvmhpvlppnsddtprpvsn
>d4aaoa2 a.3.1.0 (A:189-346) automated matches {Geobacter sulfurreducens [TaxId: 243231]} dapfdkylkgnrkaisstaeqglalfldkgcaachsgvnmggtgyfpfgvredykvtsta adkyvfrspslrnvaitmpyfhsgkvwklkdavkimgsaqlgisitdadadkivtflntl tgaqpkvmhpvlppnsddtprpvsn
Timeline for d4aaoa2: