SCOPe 2.08: Domain d4aaoa2: 4aao A:189-346

Lineage for d4aaoa2 (4aao A:189-346)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (26 species)
   not a true protein

7. Species Geobacter sulfurreducens [TaxId:243231] [226497] (6 PDB entries)

8. Domain d4aaoa2: 4aao A:189-346 [218759]
   automated match to d1nmla2
   complexed with ca, hec, so4

Details for d4aaoa2

PDB Entry: 4aao, 2.3 Å

PDB Description: maca-h93g

PDB Compounds: (A:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d4aaoa2:

Sequence, based on SEQRES records:

>d4aaoa2 a.3.1.0 (A:189-346) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
dapfdkylkgnrkaisstaeqglalfldkgcaachsgvnmggtgyfpfgvredpgpvvrp
vddtgrykvtstaadkyvfrspslrnvaitmpyfhsgkvwklkdavkimgsaqlgisitd
adadkivtflntltgaqpkvmhpvlppnsddtprpvsn

Sequence, based on observed residues (ATOM records):

>d4aaoa2 a.3.1.0 (A:189-346) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
dapfdkylkgnrkaisstaeqglalfldkgcaachsgvnmggtgyfpfgvredykvtsta
adkyvfrspslrnvaitmpyfhsgkvwklkdavkimgsaqlgisitdadadkivtflntl
tgaqpkvmhpvlppnsddtprpvsn

Timeline for d4aaoa2:

• d4aaoa2 first appeared in SCOPe 2.03
  
• d4aaoa2 appears in SCOPe 2.07