SCOPe 2.05: Domain d4aama2: 4aam A:189-346

Lineage for d4aama2 (4aam A:189-346)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (18 species)
   not a true protein

7. Species Geobacter sulfurreducens [TaxId:243231] [226497] (4 PDB entries)

8. Domain d4aama2: 4aam A:189-346 [218755]
   automated match to d1nmla2
   complexed with ca, hec, so4

Details for d4aama2

PDB Entry: 4aam, 2.17 Å

PDB Description: MacA wild-type mixed-valence

PDB Compounds: (A:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d4aama2:

Sequence; same for both SEQRES and ATOM records:

>d4aama2 a.3.1.0 (A:189-346) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
dapfdkylkgnrkaisstaeqglalfldkgcaachsgvnmggtgyfpfgvredpgpvvrp
vddtgrykvtstaadkyvfrspslrnvaitmpyfhsgkvwklkdavkimgsaqlgisitd
adadkivtflntltgaqpkvmhpvlppnsddtprpvsn

Timeline for d4aama2:

• d4aama2 first appeared in SCOPe 2.03
  
• d4aama2 appears in SCOPe 2.04
  
• d4aama2 appears in SCOPe 2.06
  
• d4aama2 appears in the current release, SCOPe 2.08