Lineage for d4aama2 (4aam A:189-346)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691615Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2691616Protein automated matches [190453] (26 species)
    not a true protein
  7. 2691637Species Geobacter sulfurreducens [TaxId:243231] [226497] (6 PDB entries)
  8. 2691642Domain d4aama2: 4aam A:189-346 [218755]
    automated match to d1nmla2
    complexed with ca, hec, so4

Details for d4aama2

PDB Entry: 4aam (more details), 2.17 Å

PDB Description: MacA wild-type mixed-valence
PDB Compounds: (A:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d4aama2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aama2 a.3.1.0 (A:189-346) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
dapfdkylkgnrkaisstaeqglalfldkgcaachsgvnmggtgyfpfgvredpgpvvrp
vddtgrykvtstaadkyvfrspslrnvaitmpyfhsgkvwklkdavkimgsaqlgisitd
adadkivtflntltgaqpkvmhpvlppnsddtprpvsn

SCOPe Domain Coordinates for d4aama2:

Click to download the PDB-style file with coordinates for d4aama2.
(The format of our PDB-style files is described here.)

Timeline for d4aama2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4aama1