SCOPe 2.06: Domain d4aalb2: 4aal B:189-346

Lineage for d4aalb2 (4aal B:189-346)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (22 species)
   not a true protein

7. Species Geobacter sulfurreducens [TaxId:243231] [226497] (5 PDB entries)

8. Domain d4aalb2: 4aal B:189-346 [218753]
   automated match to d1nmla2
   complexed with act, ca, eoh, hec, po4

Details for d4aalb2

PDB Entry: 4aal, 1.84 Å

PDB Description: maca wild-type oxidized

PDB Compounds: (B:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d4aalb2:

Sequence, based on SEQRES records:

>d4aalb2 a.3.1.0 (B:189-346) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
dapfdkylkgnrkaisstaeqglalfldkgcaachsgvnmggtgyfpfgvredpgpvvrp
vddtgrykvtstaadkyvfrspslrnvaitmpyfhsgkvwklkdavkimgsaqlgisitd
adadkivtflntltgaqpkvmhpvlppnsddtprpvsn

Sequence, based on observed residues (ATOM records):

>d4aalb2 a.3.1.0 (B:189-346) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
dapfdkylkgnrkaisstaeqglalfldkgcaachsgvnmggtgyfpfgvredpgvddtg
rykvtstaadkyvfrspslrnvaitmpyfhsgkvwklkdavkimgsaqlgisitdadadk
ivtflntltgaqpkvmhpvlppnsddtprpvsn

Timeline for d4aalb2:

• d4aalb2 first appeared in SCOPe 2.03
  
• d4aalb2 appears in SCOPe 2.05
  
• d4aalb2 appears in SCOPe 2.07
  
• d4aalb2 appears in the current release, SCOPe 2.08