Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
Protein automated matches [190453] (22 species) not a true protein |
Species Geobacter sulfurreducens [TaxId:243231] [226497] (5 PDB entries) |
Domain d4aalb2: 4aal B:189-346 [218753] automated match to d1nmla2 complexed with act, ca, eoh, hec, po4 |
PDB Entry: 4aal (more details), 1.84 Å
SCOPe Domain Sequences for d4aalb2:
Sequence, based on SEQRES records: (download)
>d4aalb2 a.3.1.0 (B:189-346) automated matches {Geobacter sulfurreducens [TaxId: 243231]} dapfdkylkgnrkaisstaeqglalfldkgcaachsgvnmggtgyfpfgvredpgpvvrp vddtgrykvtstaadkyvfrspslrnvaitmpyfhsgkvwklkdavkimgsaqlgisitd adadkivtflntltgaqpkvmhpvlppnsddtprpvsn
>d4aalb2 a.3.1.0 (B:189-346) automated matches {Geobacter sulfurreducens [TaxId: 243231]} dapfdkylkgnrkaisstaeqglalfldkgcaachsgvnmggtgyfpfgvredpgvddtg rykvtstaadkyvfrspslrnvaitmpyfhsgkvwklkdavkimgsaqlgisitdadadk ivtflntltgaqpkvmhpvlppnsddtprpvsn
Timeline for d4aalb2: