Lineage for d1ehna1 (1ehn A:24-132)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456110Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 456196Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (17 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 456216Protein Chitinase A, N-terminal domain N [49233] (1 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. 456217Species Serratia marcescens [TaxId:615] [49234] (8 PDB entries)
  8. 456222Domain d1ehna1: 1ehn A:24-132 [21875]
    Other proteins in same PDB: d1ehna2, d1ehna3

Details for d1ehna1

PDB Entry: 1ehn (more details), 1.9 Å

PDB Description: crystal structure of chitinase a mutant e315q complexed with octa-n- acetylchitooctaose (nag)8.

SCOP Domain Sequences for d1ehna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehna1 b.1.18.2 (A:24-132) Chitinase A, N-terminal domain N {Serratia marcescens}
aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakvllng
keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad

SCOP Domain Coordinates for d1ehna1:

Click to download the PDB-style file with coordinates for d1ehna1.
(The format of our PDB-style files is described here.)

Timeline for d1ehna1: