Lineage for d1ehna1 (1ehn A:24-132)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9610Protein Chitinase A, N-terminal domain [49233] (1 species)
  7. 9611Species Serratia marcescens [TaxId:615] [49234] (4 PDB entries)
  8. 9614Domain d1ehna1: 1ehn A:24-132 [21875]
    Other proteins in same PDB: d1ehna2, d1ehna3

Details for d1ehna1

PDB Entry: 1ehn (more details), 1.9 Å

PDB Description: crystal structure of chitinase a mutant e315q complexed with octa-n- acetylchitooctaose (nag)8.

SCOP Domain Sequences for d1ehna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehna1 b.1.1.5 (A:24-132) Chitinase A, N-terminal domain {Serratia marcescens}
aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakvllng
keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad

SCOP Domain Coordinates for d1ehna1:

Click to download the PDB-style file with coordinates for d1ehna1.
(The format of our PDB-style files is described here.)

Timeline for d1ehna1: