Lineage for d4aaja_ (4aaj A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815757Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1816492Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 1816493Protein automated matches [190292] (26 species)
    not a true protein
  7. 1816618Species Pyrococcus furiosus [TaxId:2261] [226511] (1 PDB entry)
  8. 1816619Domain d4aaja_: 4aaj A: [218749]
    automated match to d1nsja_
    complexed with so4

Details for d4aaja_

PDB Entry: 4aaj (more details), 1.75 Å

PDB Description: Structure of N-(5'-phosphoribosyl)anthranilate isomerase from Pyrococcus furiosus
PDB Compounds: (A:) n-(5'-phosphoribosyl)anthranilate isomerase

SCOPe Domain Sequences for d4aaja_:

Sequence, based on SEQRES records: (download)

>d4aaja_ c.1.2.0 (A:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
hmfvkicgiksleeleivekhadatgvvvnsnskrriplekareiiensaipvflvstmv
gfsewamaiertgaqyiqvhsnalpqtidtlkkefgvfvmkafrvptisknpeedanrll
seisrynadmvlldtgagsgklhdlrvsslvarkipvivagglnaenveevikvvkpygv
dvssgvekygikdpklveefvrraknv

Sequence, based on observed residues (ATOM records): (download)

>d4aaja_ c.1.2.0 (A:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
hmfvkicgiksleeleivekhadatgvvvnsnskrriplekareiiensaipvflvstmv
gfsewamaiertgaqyiqvhsnalpqtidtlkkefgvfvmkafrvptisknpeedanrll
seisrynadmvlldthdlrvsslvarkipvivagglnaenveevikvvkpygvdvssgve
kygikdpklveefvrraknv

SCOPe Domain Coordinates for d4aaja_:

Click to download the PDB-style file with coordinates for d4aaja_.
(The format of our PDB-style files is described here.)

Timeline for d4aaja_: