SCOPe 2.03: Domain d4aaja_: 4aaj A:

Lineage for d4aaja_ (4aaj A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.0: automated matches [191350] (1 protein)
   not a true family

6. Protein automated matches [190292] (20 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [226511] (1 PDB entry)

8. Domain d4aaja_: 4aaj A: [218749]
   automated match to d1nsja_
   complexed with so4

Details for d4aaja_

PDB Entry: 4aaj, 1.75 Å

PDB Description: structure of n-(5'-phosphoribosyl)anthranilate isomerase from pyrococcus furiosus

PDB Compounds: (A:) n-(5'-phosphoribosyl)anthranilate isomerase

SCOPe Domain Sequences for d4aaja_:

Sequence, based on SEQRES records:

>d4aaja_ c.1.2.0 (A:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
hmfvkicgiksleeleivekhadatgvvvnsnskrriplekareiiensaipvflvstmv
gfsewamaiertgaqyiqvhsnalpqtidtlkkefgvfvmkafrvptisknpeedanrll
seisrynadmvlldtgagsgklhdlrvsslvarkipvivagglnaenveevikvvkpygv
dvssgvekygikdpklveefvrraknv

Sequence, based on observed residues (ATOM records):

>d4aaja_ c.1.2.0 (A:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
hmfvkicgiksleeleivekhadatgvvvnsnskrriplekareiiensaipvflvstmv
gfsewamaiertgaqyiqvhsnalpqtidtlkkefgvfvmkafrvptisknpeedanrll
seisrynadmvlldthdlrvsslvarkipvivagglnaenveevikvvkpygvdvssgve
kygikdpklveefvrraknv

Timeline for d4aaja_:

• d4aaja_ is new in SCOPe 2.03-stable
  
• d4aaja_ appears in SCOPe 2.04
  
• d4aaja_ appears in the current release, SCOPe 2.08, called d4aaja1