Lineage for d4aaja1 (4aaj A:1-206)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (34 species)
    not a true protein
  7. 2079921Species Pyrococcus furiosus [TaxId:2261] [226511] (1 PDB entry)
  8. 2079922Domain d4aaja1: 4aaj A:1-206 [218749]
    Other proteins in same PDB: d4aaja2
    automated match to d1nsja_
    complexed with so4

Details for d4aaja1

PDB Entry: 4aaj (more details), 1.75 Å

PDB Description: Structure of N-(5'-phosphoribosyl)anthranilate isomerase from Pyrococcus furiosus
PDB Compounds: (A:) n-(5'-phosphoribosyl)anthranilate isomerase

SCOPe Domain Sequences for d4aaja1:

Sequence, based on SEQRES records: (download)

>d4aaja1 c.1.2.0 (A:1-206) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mfvkicgiksleeleivekhadatgvvvnsnskrriplekareiiensaipvflvstmvg
fsewamaiertgaqyiqvhsnalpqtidtlkkefgvfvmkafrvptisknpeedanrlls
eisrynadmvlldtgagsgklhdlrvsslvarkipvivagglnaenveevikvvkpygvd
vssgvekygikdpklveefvrraknv

Sequence, based on observed residues (ATOM records): (download)

>d4aaja1 c.1.2.0 (A:1-206) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mfvkicgiksleeleivekhadatgvvvnsnskrriplekareiiensaipvflvstmvg
fsewamaiertgaqyiqvhsnalpqtidtlkkefgvfvmkafrvptisknpeedanrlls
eisrynadmvlldthdlrvsslvarkipvivagglnaenveevikvvkpygvdvssgvek
ygikdpklveefvrraknv

SCOPe Domain Coordinates for d4aaja1:

Click to download the PDB-style file with coordinates for d4aaja1.
(The format of our PDB-style files is described here.)

Timeline for d4aaja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4aaja2