SCOPe 2.06: Domain d4a9ic_: 4a9i C:

Lineage for d4a9ic_ (4a9i C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries)

8. Domain d4a9ic_: 4a9i C: [218731]
   Other proteins in same PDB: d4a9ib2
   automated match to d3zyub_
   complexed with edo, p9i, so4

Details for d4a9ic_

PDB Entry: 4a9i, 2.25 Å

PDB Description: n-terminal bromodomain of human brd2 with 3-methyl-1,2,3,4- tetrahydroquinazolin-2-one

PDB Compounds: (C:) bromodomain containing 2

SCOPe Domain Sequences for d4a9ic_:

Sequence; same for both SEQRES and ATOM records:

>d4a9ic_ a.29.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlennyy
waasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpq

Timeline for d4a9ic_:

• d4a9ic_ first appeared in SCOPe 2.03
  
• d4a9ic_ appears in SCOPe 2.05
  
• d4a9ic_ appears in SCOPe 2.07
  
• d4a9ic_ appears in the current release, SCOPe 2.08