Lineage for d4a9ia_ (4a9i A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731437Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1731536Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1731537Protein automated matches [190615] (7 species)
    not a true protein
  7. 1731541Species Human (Homo sapiens) [TaxId:9606] [187641] (258 PDB entries)
  8. 1731804Domain d4a9ia_: 4a9i A: [218729]
    automated match to d3zyub_
    complexed with edo, p9i, so4

Details for d4a9ia_

PDB Entry: 4a9i (more details), 2.25 Å

PDB Description: n-terminal bromodomain of human brd2 with 3-methyl-1,2,3,4- tetrahydroquinazolin-2-one
PDB Compounds: (A:) bromodomain containing 2

SCOPe Domain Sequences for d4a9ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a9ia_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlenny
ywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpqee

SCOPe Domain Coordinates for d4a9ia_:

Click to download the PDB-style file with coordinates for d4a9ia_.
(The format of our PDB-style files is described here.)

Timeline for d4a9ia_: