Lineage for d4a9ec_ (4a9e C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2707959Domain d4a9ec_: 4a9e C: [218722]
    automated match to d3zyub_
    complexed with 3pf, edo, so4

Details for d4a9ec_

PDB Entry: 4a9e (more details), 1.91 Å

PDB Description: n-terminal bromodomain of human brd2 with 3-methyl-1,2,3,4- tetrahydroquinazolin-2-one
PDB Compounds: (C:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d4a9ec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a9ec_ a.29.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlennyy
waasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpq

SCOPe Domain Coordinates for d4a9ec_:

Click to download the PDB-style file with coordinates for d4a9ec_.
(The format of our PDB-style files is described here.)

Timeline for d4a9ec_: