Lineage for d1clc_2 (1clc 35-134)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54510Family b.1.1.5: E set domains [49208] (24 proteins)
  6. 54535Protein CelD cellulase, N-terminal domain [49231] (1 species)
  7. 54536Species Clostridium thermocellum [TaxId:1515] [49232] (1 PDB entry)
  8. 54537Domain d1clc_2: 1clc 35-134 [21872]
    Other proteins in same PDB: d1clc_1

Details for d1clc_2

PDB Entry: 1clc (more details), 1.9 Å

PDB Description: three-dimensional structure of endoglucanase d at 1.9 angstroms resolution

SCOP Domain Sequences for d1clc_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clc_2 b.1.1.5 (35-134) CelD cellulase, N-terminal domain {Clostridium thermocellum}
ietkvsaakitenyqfdsrirlnsigfipnhskkatiaancstfyvvkedgtivytgtat
smfdndtketvyiadfssvneegtyylavpgvgksvnfki

SCOP Domain Coordinates for d1clc_2:

Click to download the PDB-style file with coordinates for d1clc_2.
(The format of our PDB-style files is described here.)

Timeline for d1clc_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1clc_1