SCOPe 2.06: Domain d4a8xa1: 4a8x A:159-244

Lineage for d4a8xa1 (4a8x A:159-244)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (87 PDB entries)

8. Domain d4a8xa1: 4a8x A:159-244 [218719]
   Other proteins in same PDB: d4a8xa2
   automated match to d2cqia1
   protein/RNA complex

Details for d4a8xa1

PDB Entry: 4a8x, 1.9 Å

PDB Description: Structure of the core ASAP complex

PDB Compounds: (A:) RNA-binding protein with serine-rich domain 1

SCOPe Domain Sequences for d4a8xa1:

Sequence; same for both SEQRES and ATOM records:

>d4a8xa1 d.58.7.0 (A:159-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kptkvhigrltrnvtkdhimeifstygkikmidmpvermhphlskgyayvefenpdeaek
alkhmdggqidgqeitatavlapwpr

Timeline for d4a8xa1:

• d4a8xa1 first appeared in SCOPe 2.03, called d4a8xa_
  
• d4a8xa1 was called d4a8xa_ in SCOPe 2.05
  
• d4a8xa1 appears in SCOPe 2.07
  
• d4a8xa1 appears in the current release, SCOPe 2.08