![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins) |
![]() | Protein automated matches [190058] (6 species) not a true protein |
![]() | Species Betula pendula [TaxId:3505] [195294] (4 PDB entries) |
![]() | Domain d4a8ua_: 4a8u A: [218718] automated match to d4a8va_ complexed with mpd, mrd, so4, trs |
PDB Entry: 4a8u (more details), 1.16 Å
SCOPe Domain Sequences for d4a8ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a8ua_ d.129.3.1 (A:) automated matches {Betula pendula [TaxId: 3505]} gvfnyeteatsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe gfpfkyvkdrvdevdhtnfkysysvieggpvgdtlekisneikivatpnggsilkinnky htkgdhevkaeqikaskemgetllravesyllahsdayn
Timeline for d4a8ua_: