SCOPe 2.03: Domain d4a82d2: 4a82 D:324-578

Lineage for d4a82d2 (4a82 D:324-578)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein Putative multidrug export ATP-binding/permease protein SAV1866 [142303] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [224888] (1 PDB entry)

8. Domain d4a82d2: 4a82 D:324-578 [218709]
   Other proteins in same PDB: d4a82a1, d4a82b1, d4a82c1, d4a82d1
   automated match to d2hyda1

Details for d4a82d2

PDB Entry: 4a82, 2 Å

PDB Description: Fitted model of staphylococcus aureus sav1866 model ABC transporter in the human cystic fibrosis transmembrane conductance regulator volume map EMD-1966.

PDB Compounds: (D:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d4a82d2:

Sequence; same for both SEQRES and ATOM records:

>d4a82d2 c.37.1.12 (D:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Human (Homo sapiens) [TaxId: 9606]}
ikngvgaqpieikqgrididhvsfqyndneapilkdinlsiekgetvafvgmsgggkstl
inliprfydvtsgqilidghnikdfltgslrnqiglvqqdnilfsdtvkenillgrptat
deevveaakmanahdfimnlpqgydtevgergvklsggqkqrlsiariflnnppililde
atsaldlesesiiqealdvlskdrttlivahrlstithadkivvienghivetgthreli
akqgayehlysiqnl

Timeline for d4a82d2:

• d4a82d2 is new in SCOPe 2.03-stable
  
• d4a82d2 appears in SCOPe 2.04
  
• d4a82d2 appears in the current release, SCOPe 2.08