Lineage for d4a81a_ (4a81 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214908Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2214909Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2214919Protein Major tree pollen allergen [55963] (4 species)
  7. 2214930Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (22 PDB entries)
  8. 2214944Domain d4a81a_: 4a81 A: [218701]
    automated match to d4a85a_
    complexed with 2an, dxc, mpd, na, so4

Details for d4a81a_

PDB Entry: 4a81 (more details), 2.05 Å

PDB Description: crystal structure of major birch pollen allergen bet v 1 a in ternary complex with 8-anilinonaphthalene-1-sulfonate (ans) and deoxycholic acid
PDB Compounds: (A:) major pollen allergen bet v 1-a

SCOPe Domain Sequences for d4a81a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a81a_ d.129.3.1 (A:) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1 [TaxId: 3505]}
gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
htkgdhevkaeqvkaskemgetllravesyllahsdayn

SCOPe Domain Coordinates for d4a81a_:

Click to download the PDB-style file with coordinates for d4a81a_.
(The format of our PDB-style files is described here.)

Timeline for d4a81a_: