SCOPe 2.05: Domain d4a81a_: 4a81 A:

Lineage for d4a81a_ (4a81 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)

6. Protein Major tree pollen allergen [55963] (4 species)

7. Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (22 PDB entries)

8. Domain d4a81a_: 4a81 A: [218701]
   automated match to d4a85a_
   complexed with 2an, dxc, mpd, na, so4

Details for d4a81a_

PDB Entry: 4a81, 2.05 Å

PDB Description: crystal structure of major birch pollen allergen bet v 1 a in ternary complex with 8-anilinonaphthalene-1-sulfonate (ans) and deoxycholic acid

PDB Compounds: (A:) major pollen allergen bet v 1-a

SCOPe Domain Sequences for d4a81a_:

Sequence; same for both SEQRES and ATOM records:

>d4a81a_ d.129.3.1 (A:) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1 [TaxId: 3505]}
gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
htkgdhevkaeqvkaskemgetllravesyllahsdayn

Timeline for d4a81a_:

• d4a81a_ first appeared in SCOPe 2.03
  
• d4a81a_ appears in SCOPe 2.04
  
• d4a81a_ appears in SCOPe 2.06
  
• d4a81a_ appears in the current release, SCOPe 2.08