SCOP 1.75: Domain d1hc1a3: 1hc1 A:399-653

Lineage for d1hc1a3 (1hc1 A:399-653)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.3: Arthropod hemocyanin, C-terminal domain [81283] (1 protein)

6. Protein Arthropod hemocyanin, C-terminal domain [49228] (2 species)
   elaborated with many loop insertions in the common fold

7. Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [49230] (2 PDB entries)

8. Domain d1hc1a3: 1hc1 A:399-653 [21870]
   Other proteins in same PDB: d1hc1a1, d1hc1a2
   complexed with cu

Details for d1hc1a3

PDB Entry: 1hc1, 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution

PDB Compounds: (A:) arthropodan hemocyanin

SCOP Domain Sequences for d1hc1a3:

Sequence, based on SEQRES records:

>d1hc1a3 b.1.18.3 (A:399-653) Arthropod hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus) [TaxId: 6735]}
ppythdnlefsgmvvngvaidgelitffdefqyslinavdsgeniedveinarvhrlnhn
eftykitmsnnndgerlatfriflcpiednngitltldearwfcieldkffqkvpsgpet
iersskdssvtvpdmpsfqslkeqadnavngghdldlsayerscgipdrmllpkskpegm
efnlyvavtdgdkdteghngghdyggthaqcgvhgeaypdnrplgyplerripdervidg
vsnikhvvvkivhhl

Sequence, based on observed residues (ATOM records):

>d1hc1a3 b.1.18.3 (A:399-653) Arthropod hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus) [TaxId: 6735]}
ppythdnlefsgmvvngvaidgelitffdefqyslinavdsgeniedveinarvhrlnhn
eftykitmsnnndgerlatfriflcpiednngitltldearwfcieldkffqkvpsgpet
iersskdssvtvpdmpsfqslkeqadnavnggldlsayerscgipdrmllpkskpegmef
nlyvavtdgdkdteghhaqcgvhgeaypdnrplgyplerripdervidgvsnikhvvvki
vhhl

Timeline for d1hc1a3:

• d1hc1a3 first appeared (with stable ids) in SCOP 1.55, called d1hc1_3
  
• d1hc1a3 appears in SCOP 1.73
  
• d1hc1a3 appears in SCOPe 2.01
  
• d1hc1a3 appears in the current release, SCOPe 2.08