Lineage for d4a7xd_ (4a7x D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905281Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. 2905282Protein automated matches [190728] (15 species)
    not a true protein
  7. 2905396Species Helicobacter pylori [TaxId:85962] [195071] (2 PDB entries)
  8. 2905402Domain d4a7xd_: 4a7x D: [218697]
    automated match to d4a7wb_
    complexed with udp

Details for d4a7xd_

PDB Entry: 4a7x (more details), 2.49 Å

PDB Description: Crystal structure of uridylate kinase from Helicobacter pylori
PDB Compounds: (D:) uridylate kinase

SCOPe Domain Sequences for d4a7xd_:

Sequence, based on SEQRES records: (download)

>d4a7xd_ c.73.1.0 (D:) automated matches {Helicobacter pylori [TaxId: 85962]}
nkrvlvkfsgealagdnqfgidihvldhiakeikslvendievgivigggniirgvsaaq
ggiirrtsgdymgmlatvinavamqealehigldtrvqsaieikeicesyiyrkairhle
kgrvvifgagtgnpffttdtaatlraieigsdliikatkvdgiydkdpnkfkdakkldtl
syndaligdievmddtaislakdnklpivvcnmfkkgnllqvikhqqgvfsmvk

Sequence, based on observed residues (ATOM records): (download)

>d4a7xd_ c.73.1.0 (D:) automated matches {Helicobacter pylori [TaxId: 85962]}
nkrvlvkfsgealagdnqfgidihvldhiakeikslvendievgivigggniirgvsaaq
ggiirrtsgdymgmlatvinavamqealehigldtrvqsaieikeicesyiyrkairhle
kgrvvifgagtgnpffttdtaatlraieigsdliikatkvdgiydkdakkldtlsyndal
igdievmddtaislakdnklpivvcnmfkkgnllqvikhqqgvfsmvk

SCOPe Domain Coordinates for d4a7xd_:

Click to download the PDB-style file with coordinates for d4a7xd_.
(The format of our PDB-style files is described here.)

Timeline for d4a7xd_: