SCOPe 2.03: Domain d4a7xa_: 4a7x A:

Lineage for d4a7xa_ (4a7x A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.0: automated matches [191466] (1 protein)
   not a true family

6. Protein automated matches [190728] (13 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [195071] (2 PDB entries)

8. Domain d4a7xa_: 4a7x A: [218694]
   automated match to d4a7wb_
   complexed with udp

Details for d4a7xa_

PDB Entry: 4a7x, 2.49 Å

PDB Description: Crystal structure of uridylate kinase from Helicobacter pylori

PDB Compounds: (A:) uridylate kinase

SCOPe Domain Sequences for d4a7xa_:

Sequence; same for both SEQRES and ATOM records:

>d4a7xa_ c.73.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
nkrvlvkfsgealagdnqfgidihvldhiakeikslvendievgivigggniirgvsaaq
ggiirrtsgdymgmlatvinavamqealehigldtrvqsaieikeicesyiyrkairhle
kgrvvifgagtgnpffttdtaatlraieigsdliikatkvdgiydkdpnkfkdakkldtl
syndaligdievmddtaislakdnklpivvcnmfkkgnllqvikhqqgvfsmvk

Timeline for d4a7xa_:

• d4a7xa_ is new in SCOPe 2.03-stable
  
• d4a7xa_ appears in SCOPe 2.04
  
• d4a7xa_ appears in the current release, SCOPe 2.08