SCOPe 2.03: Domain d4a7ga_: 4a7g A:

Lineage for d4a7ga_ (4a7g A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein automated matches [190916] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189462] (4 PDB entries)

8. Domain d4a7ga_: 4a7g A: [218690]
   Other proteins in same PDB: d4a7gf_
   automated match to d3f7la_
   complexed with 12i, act, cu, so4, zn; mutant

Details for d4a7ga_

PDB Entry: 4a7g, 1.24 Å

PDB Description: structure of human i113t sod1 mutant complexed with 4-methylpiperazin- 1-yl)quinazoline in the p21 space group.

PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d4a7ga_:

Sequence; same for both SEQRES and ATOM records:

>d4a7ga_ b.1.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvstedsvislsgdhcitgrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

Timeline for d4a7ga_:

• d4a7ga_ is new in SCOPe 2.03-stable
  
• d4a7ga_ appears in SCOPe 2.04
  
• d4a7ga_ appears in the current release, SCOPe 2.08