![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
![]() | Protein automated matches [190916] (13 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189462] (4 PDB entries) |
![]() | Domain d4a7ga_: 4a7g A: [218690] Other proteins in same PDB: d4a7gf_ automated match to d3f7la_ complexed with 12i, act, cu, so4, zn; mutant |
PDB Entry: 4a7g (more details), 1.24 Å
SCOPe Domain Sequences for d4a7ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a7ga_ b.1.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvstedsvislsgdhcitgrtlvvh ekaddlgkggneestktgnagsrlacgvigiaq
Timeline for d4a7ga_: