Lineage for d4a7ga_ (4a7g A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2764372Protein automated matches [190916] (13 species)
    not a true protein
  7. 2764390Species Human (Homo sapiens) [TaxId:9606] [189462] (4 PDB entries)
  8. 2764391Domain d4a7ga_: 4a7g A: [218690]
    Other proteins in same PDB: d4a7gf_
    automated match to d3f7la_
    complexed with 12i, act, cu, so4, zn; mutant

Details for d4a7ga_

PDB Entry: 4a7g (more details), 1.24 Å

PDB Description: structure of human i113t sod1 mutant complexed with 4-methylpiperazin- 1-yl)quinazoline in the p21 space group.
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d4a7ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a7ga_ b.1.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvstedsvislsgdhcitgrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOPe Domain Coordinates for d4a7ga_:

Click to download the PDB-style file with coordinates for d4a7ga_.
(The format of our PDB-style files is described here.)

Timeline for d4a7ga_: