SCOPe 2.08: Domain d4a7ca_: 4a7c A:

Lineage for d4a7ca_ (4a7c A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)

8. Domain d4a7ca_: 4a7c A: [218688]
   automated match to d4hw7a_
   complexed with act, e46, imd

Details for d4a7ca_

PDB Entry: 4a7c, 2.3 Å

PDB Description: Crystal structure of PIM1 kinase with ETP46546

PDB Compounds: (A:) Proto-oncogene serine/threonine-protein kinase Pim-1

SCOPe Domain Sequences for d4a7ca_:

Sequence; same for both SEQRES and ATOM records:

>d4a7ca_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevv
llkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqv
leavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppe
wiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcl
alrpsdrptfeeiqnhpwmqdvllpqetaeihlh

Timeline for d4a7ca_:

• d4a7ca_ first appeared in SCOPe 2.03
  
• d4a7ca_ appears in SCOPe 2.07