Lineage for d4a7aa2 (4a7a A:290-401)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935244Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2935245Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2935459Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 2935512Protein Monoamine oxidase B [69673] (2 species)
  7. 2935513Species Human (Homo sapiens) [TaxId:9606] [69674] (46 PDB entries)
  8. 2935520Domain d4a7aa2: 4a7a A:290-401 [218685]
    Other proteins in same PDB: d4a7aa1, d4a7ab1
    automated match to d1s3ea2
    complexed with fad, rgz

Details for d4a7aa2

PDB Entry: 4a7a (more details), 1.7 Å

PDB Description: Crystal structure of human monoamine oxidase B (MAO B) in complex with rosiglitazone
PDB Compounds: (A:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d4a7aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a7aa2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

SCOPe Domain Coordinates for d4a7aa2:

Click to download the PDB-style file with coordinates for d4a7aa2.
(The format of our PDB-style files is described here.)

Timeline for d4a7aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4a7aa1