| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (79 species) not a true protein |
| Species Amycolatopsis sp. [TaxId:37632] [226810] (1 PDB entry) |
| Domain d4a6ga2: 4a6g A:126-368 [218671] Other proteins in same PDB: d4a6ga1, d4a6gb1, d4a6gc1, d4a6gd1 automated match to d1wufa1 complexed with ame, mg; mutant |
PDB Entry: 4a6g (more details), 2.71 Å
SCOPe Domain Sequences for d4a6ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a6ga2 c.1.11.0 (A:126-368) automated matches {Amycolatopsis sp. [TaxId: 37632]}
vrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerfgddvl
lqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpicldesivsa
raaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgraanval
aslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevttakvw
igs
Timeline for d4a6ga2: