SCOPe 2.06: Domain d4a6ga1: 4a6g A:1-125

Lineage for d4a6ga1 (4a6g A:1-125)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Amycolatopsis sp. [TaxId:37632] [226521] (6 PDB entries)

8. Domain d4a6ga1: 4a6g A:1-125 [218670]
   Other proteins in same PDB: d4a6ga2, d4a6gb2, d4a6gc2, d4a6gd2
   automated match to d1wufa2
   complexed with ame, mg; mutant

Details for d4a6ga1

PDB Entry: 4a6g, 2.71 Å

PDB Description: N-acyl amino acid racemase from Amycalotopsis sp. Ts-1-60: G291D- F323Y mutant in complex with N-acetyl methionine

PDB Compounds: (A:) N-acylamino acid racemase

SCOPe Domain Sequences for d4a6ga1:

Sequence; same for both SEQRES and ATOM records:

>d4a6ga1 d.54.1.0 (A:1-125) automated matches {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

Timeline for d4a6ga1:

• d4a6ga1 first appeared in SCOPe 2.03
  
• d4a6ga1 appears in SCOPe 2.05
  
• d4a6ga1 appears in SCOPe 2.07
  
• d4a6ga1 appears in the current release, SCOPe 2.08