Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Amycolatopsis sp. [TaxId:37632] [226521] (6 PDB entries) |
Domain d4a6ga1: 4a6g A:1-125 [218670] Other proteins in same PDB: d4a6ga2, d4a6gb2, d4a6gc2, d4a6gd2 automated match to d1wufa2 complexed with ame, mg; mutant |
PDB Entry: 4a6g (more details), 2.71 Å
SCOPe Domain Sequences for d4a6ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a6ga1 d.54.1.0 (A:1-125) automated matches {Amycolatopsis sp. [TaxId: 37632]} mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa aelgs
Timeline for d4a6ga1: