Lineage for d4a5xb_ (4a5x B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1481355Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1481714Superfamily a.7.14: MIT domain [116846] (2 families) (S)
  5. 1481728Family a.7.14.0: automated matches [191520] (1 protein)
    not a true family
  6. 1481729Protein automated matches [190877] (3 species)
    not a true protein
  7. 1481735Species Human (Homo sapiens) [TaxId:9606] [226520] (3 PDB entries)
  8. 1481737Domain d4a5xb_: 4a5x B: [218668]
    automated match to d2v6xa_
    complexed with gol, p15

Details for d4a5xb_

PDB Entry: 4a5x (more details), 1.91 Å

PDB Description: Structures of MITD1
PDB Compounds: (B:) mit domain-containing protein 1

SCOPe Domain Sequences for d4a5xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a5xb_ a.7.14.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpqstaaatvlkraveldsesrypqalvcyqegidlllqvlkgtkdntkrcnlrekisky
mdraenikkyldq

SCOPe Domain Coordinates for d4a5xb_:

Click to download the PDB-style file with coordinates for d4a5xb_.
(The format of our PDB-style files is described here.)

Timeline for d4a5xb_: