SCOPe 2.08: Domain d4a5xa_: 4a5x A:

Lineage for d4a5xa_ (4a5x A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.14: MIT domain [116846] (2 families)

5. Family a.7.14.0: automated matches [191520] (1 protein)
   not a true family

6. Protein automated matches [190877] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226520] (3 PDB entries)

8. Domain d4a5xa_: 4a5x A: [218667]
   automated match to d2v6xa_
   complexed with gol, p15

Details for d4a5xa_

PDB Entry: 4a5x, 1.91 Å

PDB Description: Structures of MITD1

PDB Compounds: (A:) mit domain-containing protein 1

SCOPe Domain Sequences for d4a5xa_:

Sequence; same for both SEQRES and ATOM records:

>d4a5xa_ a.7.14.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqstaaatvlkraveldsesrypqalvcyqegidlllqvlkgtkdntkrcnlrekiskym
draenikkyldqe

Timeline for d4a5xa_:

• d4a5xa_ first appeared in SCOPe 2.03
  
• d4a5xa_ appears in SCOPe 2.07