Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (40 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188340] (20 PDB entries) |
Domain d4a5sb2: 4a5s B:509-773 [218666] Other proteins in same PDB: d4a5sa1, d4a5sb1 automated match to d1orva2 complexed with n7f, nag, so4 |
PDB Entry: 4a5s (more details), 1.62 Å
SCOPe Domain Sequences for d4a5sb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a5sb2 c.69.1.0 (B:509-773) automated matches {Human (Homo sapiens) [TaxId: 9606]} mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah qhiythmshfikqcfslpaaaswsh
Timeline for d4a5sb2: