Lineage for d4a5sb2 (4a5s B:509-766)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902215Species Human (Homo sapiens) [TaxId:9606] [188340] (99 PDB entries)
  8. 2902223Domain d4a5sb2: 4a5s B:509-766 [218666]
    Other proteins in same PDB: d4a5sa1, d4a5sa3, d4a5sb1, d4a5sb3
    automated match to d1orva2
    complexed with n7f, nag, so4

Details for d4a5sb2

PDB Entry: 4a5s (more details), 1.62 Å

PDB Description: crystal structure of human dpp4 in complex with a noval heterocyclic dpp4 inhibitor
PDB Compounds: (B:) Dipeptidyl peptidase 4 soluble form

SCOPe Domain Sequences for d4a5sb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a5sb2 c.69.1.0 (B:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d4a5sb2:

Click to download the PDB-style file with coordinates for d4a5sb2.
(The format of our PDB-style files is described here.)

Timeline for d4a5sb2: