![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies) consists of eight 4-stranded beta-sheet motifs; meander also found in some members of the WD40-repeat superfamily |
![]() | Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) ![]() automatically mapped to Pfam PF00930 |
![]() | Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins) Pfam PF00930 |
![]() | Protein automated matches [226889] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225823] (3 PDB entries) |
![]() | Domain d4a5sb1: 4a5s B:40-508 [218665] Other proteins in same PDB: d4a5sa2, d4a5sa3, d4a5sb2, d4a5sb3 automated match to d1orva1 complexed with n7f, nag, so4 |
PDB Entry: 4a5s (more details), 1.62 Å
SCOPe Domain Sequences for d4a5sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a5sb1 b.70.3.1 (B:40-508) automated matches {Human (Homo sapiens) [TaxId: 9606]} rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk gtwevigiealtsdylyyisneykgmpggrnlykiqlidytkvtclscelnpercqyysv sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq
Timeline for d4a5sb1: