Lineage for d4a5sa2 (4a5s A:509-767)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1871035Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1871036Protein automated matches [190543] (71 species)
    not a true protein
  7. 1871215Species Human (Homo sapiens) [TaxId:9606] [188340] (51 PDB entries)
  8. 1871219Domain d4a5sa2: 4a5s A:509-767 [218664]
    Other proteins in same PDB: d4a5sa1, d4a5sb1
    automated match to d1orva2
    complexed with n7f, nag, so4

Details for d4a5sa2

PDB Entry: 4a5s (more details), 1.62 Å

PDB Description: crystal structure of human dpp4 in complex with a noval heterocyclic dpp4 inhibitor
PDB Compounds: (A:) Dipeptidyl peptidase 4 soluble form

SCOPe Domain Sequences for d4a5sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a5sa2 c.69.1.0 (A:509-767) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslpa

SCOPe Domain Coordinates for d4a5sa2:

Click to download the PDB-style file with coordinates for d4a5sa2.
(The format of our PDB-style files is described here.)

Timeline for d4a5sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4a5sa1