Lineage for d4a5od2 (4a5o D:123-283)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095624Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196452] (27 PDB entries)
  8. 2095646Domain d4a5od2: 4a5o D:123-283 [218662]
    Other proteins in same PDB: d4a5oa1, d4a5ob1, d4a5oc1, d4a5od1
    automated match to d1b0aa1
    complexed with gol, peg

Details for d4a5od2

PDB Entry: 4a5o (more details), 2.2 Å

PDB Description: Crystal structure of Pseudomonas aeruginosa N5, N10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (FolD)
PDB Compounds: (D:) Bifunctional protein folD

SCOPe Domain Sequences for d4a5od2:

Sequence, based on SEQRES records: (download)

>d4a5od2 c.2.1.0 (D:123-283) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
fhpynigrlaqrmpllrpctpkgimtllastgadlygmdavvvgasnivgrpmalelllg
gctvtvthrftrdladhvsradlvvvaagkpglvkgewikegaividvginrqadgrlvg
dveyevaaqraswitpvpggvgpmtracllentlhaaehlh

Sequence, based on observed residues (ATOM records): (download)

>d4a5od2 c.2.1.0 (D:123-283) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
fhpynigrlaqrmpllrpctpkgimtllastgadlygmdavvvgasnivgrpmalelllg
gctvtvthrftrdladhvsradlvvvaagkpglvkgewikegaividvgigdveyevaaq
raswitpvpggvgpmtracllentlhaaehlh

SCOPe Domain Coordinates for d4a5od2:

Click to download the PDB-style file with coordinates for d4a5od2.
(The format of our PDB-style files is described here.)

Timeline for d4a5od2: