Lineage for d4a5od1 (4a5o D:2-122)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143051Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2143052Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2143365Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2143366Protein automated matches [226864] (29 species)
    not a true protein
  7. 2143508Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [226249] (1 PDB entry)
  8. 2143512Domain d4a5od1: 4a5o D:2-122 [218661]
    Other proteins in same PDB: d4a5oa2, d4a5ob2, d4a5oc2, d4a5od2
    automated match to d1b0aa2
    complexed with gol, peg

Details for d4a5od1

PDB Entry: 4a5o (more details), 2.2 Å

PDB Description: Crystal structure of Pseudomonas aeruginosa N5, N10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (FolD)
PDB Compounds: (D:) Bifunctional protein folD

SCOPe Domain Sequences for d4a5od1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a5od1 c.58.1.0 (D:2-122) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
taqlidgkaiaanlrqqiaqrvterrqqglrvpglavilvgtdpasqvyvahkrkdceev
gflsqaydlpaetsqddllalidrlnddpaidgilvqlplpahldaslllerihpdkdvd
g

SCOPe Domain Coordinates for d4a5od1:

Click to download the PDB-style file with coordinates for d4a5od1.
(The format of our PDB-style files is described here.)

Timeline for d4a5od1: