| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196452] (30 PDB entries) |
| Domain d4a5oc2: 4a5o C:123-284 [218660] Other proteins in same PDB: d4a5oa1, d4a5ob1, d4a5oc1, d4a5od1 automated match to d1b0aa1 complexed with gol, peg |
PDB Entry: 4a5o (more details), 2.2 Å
SCOPe Domain Sequences for d4a5oc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a5oc2 c.2.1.0 (C:123-284) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
fhpynigrlaqrmpllrpctpkgimtllastgadlygmdavvvgasnivgrpmalelllg
gctvtvthrftrdladhvsradlvvvaagkpglvkgewikegaividvginrqadgrlvg
dveyevaaqraswitpvpggvgpmtracllentlhaaehlhd
Timeline for d4a5oc2: