SCOPe 2.04: Domain d4a5ob2: 4a5o B:123-284

Lineage for d4a5ob2 (4a5o B:123-284)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [196452] (24 PDB entries)

8. Domain d4a5ob2: 4a5o B:123-284 [218658]
   Other proteins in same PDB: d4a5oa1, d4a5ob1, d4a5oc1, d4a5od1
   automated match to d1b0aa1
   complexed with gol, peg

Details for d4a5ob2

PDB Entry: 4a5o, 2.2 Å

PDB Description: Crystal structure of Pseudomonas aeruginosa N5, N10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (FolD)

PDB Compounds: (B:) Bifunctional protein folD

SCOPe Domain Sequences for d4a5ob2:

Sequence; same for both SEQRES and ATOM records:

>d4a5ob2 c.2.1.0 (B:123-284) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
fhpynigrlaqrmpllrpctpkgimtllastgadlygmdavvvgasnivgrpmalelllg
gctvtvthrftrdladhvsradlvvvaagkpglvkgewikegaividvginrqadgrlvg
dveyevaaqraswitpvpggvgpmtracllentlhaaehlhd

Timeline for d4a5ob2:

• d4a5ob2 first appeared in SCOPe 2.03
  
• d4a5ob2 appears in SCOPe 2.05
  
• d4a5ob2 appears in the current release, SCOPe 2.08