Lineage for d4a51c_ (4a51 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111569Protein Kinesin [52646] (7 species)
  7. 2111576Species Human (Homo sapiens), mitotic kinesin eg5 [TaxId:9606] [64018] (13 PDB entries)
  8. 2111597Domain d4a51c_: 4a51 C: [218646]
    automated match to d2gm1a_
    complexed with adp, cl, dq8, mg, so4

Details for d4a51c_

PDB Entry: 4a51 (more details), 2.75 Å

PDB Description: Crystal structure of human kinesin Eg5 in complex with 1-(3-(((2-Aminoethyl)thio)diphenylmethyl)phenyl)ethanone hydrochloride
PDB Compounds: (C:) Kinesin-like protein KIF11

SCOPe Domain Sequences for d4a51c_:

Sequence, based on SEQRES records: (download)

>d4a51c_ c.37.1.9 (C:) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]}
niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
igklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphvpyresklt
rilqdslggrtrtsiiatispaslnleetlstleyahraknilnkpevn

Sequence, based on observed residues (ATOM records): (download)

>d4a51c_ c.37.1.9 (C:) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]}
niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkvkigklnlvdl
agsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsiiatispasl
nleetlstleyahraknilnkpevn

SCOPe Domain Coordinates for d4a51c_:

Click to download the PDB-style file with coordinates for d4a51c_.
(The format of our PDB-style files is described here.)

Timeline for d4a51c_: