SCOP 1.65: Domain d1ll1_3: 1ll1 380-628

Lineage for d1ll1_3 (1ll1 380-628)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.3: Arthropod hemocyanin, C-terminal domain [81283] (1 protein)

6. Protein Arthropod hemocyanin, C-terminal domain [49228] (2 species)
   elaborated with many loop insertions in the common fold

7. Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [49229] (4 PDB entries)

8. Domain d1ll1_3: 1ll1 380-628 [21864]
   Other proteins in same PDB: d1ll1_1, d1ll1_2
   complexed with cl, cu

Details for d1ll1_3

PDB Entry: 1ll1, 2.55 Å

PDB Description: hydroxo bridge met form hemocyanin from limulus

SCOP Domain Sequences for d1ll1_3:

Sequence; same for both SEQRES and ATOM records:

>d1ll1_3 b.1.18.3 (380-628) Arthropod hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus)}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllseycscgwpshllvpkgnikgmeyhlfvmltdwdkdkv
vacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikdikikfhe

Timeline for d1ll1_3:

• d1ll1_3 first appeared (with stable ids) in SCOP 1.55
  
• d1ll1_3 appears in SCOP 1.63
  
• d1ll1_3 appears in SCOP 1.67
  
• d1ll1_3 appears in the current release, SCOPe 2.08, called d1ll1a3