Lineage for d1ll1_3 (1ll1 380-628)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.5: E set domains [49208] (27 proteins) 
Protein Hemocyanin, C-terminal domain [49228] (2 species) Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [49229] (4 PDB entries) 
Domain d1ll1_3: 1ll1 380-628 [21864]
Other proteins in same PDB: d1ll1_1, d1ll1_2
Details for d1ll1_3
PDB Entry: 1ll1 (more details), 2.55 Å
PDB Description: hydroxo bridge met form hemocyanin from limulus
SCOP Domain Sequences for d1ll1_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ll1_3 b.1.1.5 (380-628) Hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus)}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllseycscgwpshllvpkgnikgmeyhlfvmltdwdkdkv
vacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikdikikfhe
SCOP Domain Coordinates for d1ll1_3:
Click to download the PDB-style file with coordinates for d1ll1_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ll1_3:
- d1ll1_3 first appeared (with stable ids) in SCOP 1.55
- d1ll1_3 appears in SCOP 1.59
- d1ll1_3 appears in SCOP 1.63
- d1ll1_3 appears in the current release, SCOPe 2.08, called d1ll1a3
View in 3D
