Lineage for d1ll1a3 (1ll1 A:380-628)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2032482Family b.1.18.3: Arthropod hemocyanin, C-terminal domain [81283] (1 protein)
    automatically mapped to Pfam PF03723
  6. 2032483Protein Arthropod hemocyanin, C-terminal domain [49228] (2 species)
    elaborated with many loop insertions in the common fold
  7. 2032484Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [49229] (4 PDB entries)
  8. 2032488Domain d1ll1a3: 1ll1 A:380-628 [21864]
    Other proteins in same PDB: d1ll1a1, d1ll1a2
    complexed with cl, cu

Details for d1ll1a3

PDB Entry: 1ll1 (more details), 2.55 Å

PDB Description: hydroxo bridge met form hemocyanin from limulus
PDB Compounds: (A:) metcyanin II

SCOPe Domain Sequences for d1ll1a3:

Sequence, based on SEQRES records: (download)

>d1ll1a3 b.1.18.3 (A:380-628) Arthropod hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllhgvglnehkseycscgwpshllvpkgnikgmeyhlfvm
ltdwdkdkvdgsesvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfi
kdikikfhe

Sequence, based on observed residues (ATOM records): (download)

>d1ll1a3 b.1.18.3 (A:380-628) Arthropod hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllseycscgwpshllvpkgnikgmeyhlfvmltdwdkdkv
vacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikdikikfhe

SCOPe Domain Coordinates for d1ll1a3:

Click to download the PDB-style file with coordinates for d1ll1a3.
(The format of our PDB-style files is described here.)

Timeline for d1ll1a3: