SCOPe 2.08: Domain d1ll1a3: 1ll1 A:380-628

Lineage for d1ll1a3 (1ll1 A:380-628)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.3: Arthropod hemocyanin, C-terminal domain [81283] (1 protein)
   automatically mapped to Pfam PF03723

6. Protein Arthropod hemocyanin, C-terminal domain [49228] (2 species)
   elaborated with many loop insertions in the common fold

7. Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [49229] (4 PDB entries)

8. Domain d1ll1a3: 1ll1 A:380-628 [21864]
   Other proteins in same PDB: d1ll1a1, d1ll1a2
   complexed with cl, cu

Details for d1ll1a3

PDB Entry: 1ll1, 2.55 Å

PDB Description: hydroxo bridge met form hemocyanin from limulus

PDB Compounds: (A:) metcyanin II

SCOPe Domain Sequences for d1ll1a3:

Sequence, based on SEQRES records:

>d1ll1a3 b.1.18.3 (A:380-628) Arthropod hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllhgvglnehkseycscgwpshllvpkgnikgmeyhlfvm
ltdwdkdkvdgsesvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfi
kdikikfhe

Sequence, based on observed residues (ATOM records):

>d1ll1a3 b.1.18.3 (A:380-628) Arthropod hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllseycscgwpshllvpkgnikgmeyhlfvmltdwdkdkv
vacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikdikikfhe

Timeline for d1ll1a3:

• d1ll1a3 first appeared (with stable ids) in SCOP 1.55, called d1ll1_3
  
• d1ll1a3 appears in SCOPe 2.07