SCOPe 2.06: Domain d4a3rc1: 4a3r C:1-137

Lineage for d4a3rc1 (4a3r C:1-137)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [226435] (1 PDB entry)

8. Domain d4a3rc1: 4a3r C:1-137 [218639]
   Other proteins in same PDB: d4a3ra2, d4a3rb2, d4a3rc2, d4a3rd2
   automated match to d1w6ta2
   complexed with cit, na

Details for d4a3rc1

PDB Entry: 4a3r, 2.2 Å

PDB Description: Crystal structure of Enolase from Bacillus subtilis.

PDB Compounds: (C:) enolase

SCOPe Domain Sequences for d4a3rc1:

Sequence; same for both SEQRES and ATOM records:

>d4a3rc1 d.54.1.0 (C:1-137) automated matches {Bacillus subtilis [TaxId: 1423]}
mpyivdvyarevldsrgnptvevevytetgafgralvpsgastgeyeavelrdgdkdryl
gkgvltavnnvneiiapellgfdvteqnaidqllieldgtenkgklganailgvsmacar
aaadflqiplyqylggf

Timeline for d4a3rc1:

• d4a3rc1 first appeared in SCOPe 2.03
  
• d4a3rc1 appears in SCOPe 2.05
  
• d4a3rc1 appears in SCOPe 2.07
  
• d4a3rc1 appears in the current release, SCOPe 2.08