| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
| Protein automated matches [226973] (7 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [226436] (1 PDB entry) |
| Domain d4a3ra2: 4a3r A:138-428 [218636] Other proteins in same PDB: d4a3ra1, d4a3rb1, d4a3rc1, d4a3rd1 automated match to d1w6ta1 complexed with cit, na |
PDB Entry: 4a3r (more details), 2.2 Å
SCOPe Domain Sequences for d4a3ra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a3ra2 c.1.11.1 (A:138-428) automated matches {Bacillus subtilis [TaxId: 1423]}
nsktlpvpmmnivnggehadnnvdiqefmimpvgapnfrealrmgaqifhslksvlsakg
lntavgdeggfapnlgsneealqtiveaiekagfkpgeevklamdaassefynkedgkyh
lsgegvvktsaemvdwyeelvskypiisiedgldendweghkllterlgkkvqlvgddlf
vtntkklsegikngvgnsilikvnqigtltetfdaiemakragytavishrsgetedsti
adiavatnagqiktgapsrtdrvakynqllriedqlaetaqyhginsfynl
Timeline for d4a3ra2: